ELF(44 (444/usr/lib/ld.so.1aqde$(W o"QiH^[1Z`/UcOM6mB<JL b80khN#+_C23&RE5?Sln,K';pXF]A7Yf\D.@a   G9jVP)*% >-I!T4g:=&+ 1:LTX a@  s$"l$<p$"D"8"$"D" $""@8T8 88xT\"&9@G"N<"Ya\iph@vH"}`T@H$$"8"8"8"0P$,$8 (H"4h"8"@"|h8"|&P"-$"=DQ,"X"_ flr<"}"`D"0$" 4 "$8","xx"D"""5  "hl`  "`%",@3<8H0"OW`@"el8"r$x }$"$"h"$"$" libsocket.so.1_GLOBAL_OFFSET_TABLE_exit_init_DYNAMIC_PROCEDURE_LINKAGE_TABLE__lib_version_finilibnsl.so.1_mutex_unlockreadcalloc_mutex_lockstrtol_environnss_search.stret4getpidsleeppipe__ctypemutex_destroygeteuidtolowermallocsprintf_stat.umul.remsscanfnss_delete_nss_netdb_aliasesfclosegetenvselectnss_setentstrncpystrncmpprintf__iobgetmsgfeofstrcatwrite_sigprocmask_exitpollperrorunlinkstrchrgetegidfreecloseopen___errnostrcmpfgetsputmsgfopenmemsetgetgroupsnss_getentstrcpykillfflushmemcmp_thr_sigsetmask_nss_XbyY_buf_allocsyslogmemcpystrlen_sigfillsetnss_endentfprintfsignalalarm.divtimelseeksocketgethostbynameconnectfcntlioctlshutdownlibc.so.1utimes_enddlcloseatexitsetbuferrnogetsfgetcsystemdlsym_edatadlopen_etext__filbufgethostnamestrdup_dlopen_dlclosemmap_dlsymfstatabort.mul_thr_setspecific_thr_keycreatesetlocale_thr_main_thr_getspecific.udiv h&|=R%P Z7D.\a KN$M0J< H*T)`Il x9L6SO[WX, E,48DQP3㿠@0 @D# @hĐ"@@d, @ '"@ @\@`㿐@//       㿐㿈'D'H@q@~&cx @7i" `* :`  ##֐a@D (b'D'D`H`'H@@@@' ' *'*@ D@ E @ @@Ii" `* :` (֐at@(at@㿐'D#H @  H? @ "#H@Km(֐at@e(at@㿐'D(!j*`: @o E @ @sx @ "ܕ*`: ? b֒(@~ +!b'`֐0@@$ @* :` - `"&h@!ܐ`' "ܕ*`: @R'7b@b*`:* :@ * :` ** :`ܔ * * :` * :` * :`@*`: @ *>  7* :`@*>* :`ݔ * ֐b8@' ֐b@' "ܕ*`: .֒P@'耢 (@#7@*`:* :@* :`@ >*`: .  7@*`:* :@ ֒X@֒P@'i" `@* :` ֐b`@P耢 I`"@R 9 *`: * *`: .  * cH"#HcH "#H` #@V ` @[ @O("!x@Fi" `@* :` ֐b@&"#` *" "ܕ*`: "i" `@* :` ֐b@cH"#Hb T#@ cH "#H `@Zb" @ 1" `  *`: $" ` cH"#H֐b #@ ` @Z@m@I," `   *`: i" `@* :` ֐b@p @ ""@9( 2!j `cH"#H `@ZK H @ "#H#H @ 2" @ i" `* :` ֐b@0֐c #@d `i" `* :` ֐c@# `* :`  #H @ @pL(!j*`: 2i" `* :` * @֐c85@# `* :` ֐c@@#H @ ֐cP@֐c`@H? @ "#H(2!j`@ I( 2!j`@  i b * cH "#Hi `*"  *`: . cH"#HcH "#H @5` #@ `@YvcH @#H h 3"H*`: @)@\[ `!#H h #H @ " @  *" nb""㿐i" ` * :` אa @2#H @ " @  *" 'i"8*`: @% ((a"# i(a" (a"!@6'c" @] " 㿐i" ` * :` אa0@i"8*`:  (( a @2#$㿈i" ` * :` אa@@`@-'쀢  i`@ι " i"8*`: i  @ (a"i X @ ia2i X @ ia 2#H @ H? @ "#Hi X @ ia 2㿈i" ` * :` אaP@w`@'쀢  i`@b " i"8*`: i H @ (a"i X @ ia2i X @ ia2㿈i" ` * :` אa`@6`@Ε'쀢  i`@! " i"8*`: i H @ (a"i X @ ia2i X @ ia2㿈i" ` * :` אap@ , :`*`# , : *# @  , : *#@ "  , :`*`#  " E"*`: b*: * *#@ `" #H @ b*: * *#@ `"  @?b*: * *"@ *`"L b*: * *" *L@ aT*!Tb*: * *"@ *`"L  *!\b*: * *"@ *`"L ?*!]=b*: * *"@ *`"L b*: * *" *L@ aT *!Tb*: * *"@ *`"L  *!\b*: * *"@ *`"L  *!] , :` , : * *#@ `" #H @ , : * *#@ `"  @7, : * *"@ *`"L , : * *" *L@ aT*!T, : * *"@ *`"L  *!\, : * *"@ *`"L ?*!]5, : * *"@ *`"L , : * *" *L@ aT *!T, : * *"@ *`"L  *!\, : * *"@ *`"L  *!] j `@[e ' , :`*`: , : * *" *@ a"  `@[A " 㿐i" ` * :` אa@9@Y&i" `@* :` אa@+#!ޕ*`:  # 2!אa@x7 7i" ` * :` אa@ #H @  *" "*`: "7i"8*`: ( !@ 7.iiib8 2"8*:`?"( !@ 7*`:#|* :@77i"8*`: ( !@ 7*`:#|* :@ " d* :`  @^אa@˟VcH "#H* :`*`:#\#`    @ZH? @ "#H !֕*`: -* :`*@*`  8  aח*: `* ؙ*;  *@  ٙ*;  @ '* :א@R * :א@I㿐@X3 ` אb @; @ ` ` אb8@( @p7Hߐa'.b'(#`'* :` ["    `J(@"# @W0 `>a''? $ؒ ''耢  Ԓ@88 ܘ אX@ 'Ԓ '`@ " ? '@K<"    `-ib@''? ؒ '" 'Ԓ ')@" @V`@ " ? '㿀i" ` * :` אb@n"*`: "7i"8*`:  ( !@ 77*`:"H* :@ " &* :`#\#`     @X !ו*`:  !ؗ*:  !ٙ*;   !ڛ+ ;` אb@㿈7i" ` * :` אb@i"8*`: ( !@ 7* :`  b""b ""㿀i" ` * :` אb@i"8*`: ( "!(! ` `( !@ *`:   : 7i",*`: i",*`:*`:@   " t#|7* :`  "H*`: 72#|cH "#H* :`*`:  %" 7* :`* :`*`:@ɏ2 @7* :`* :`*`:` @* :`*`(*:"   7  7i2",#H h '7i*`:",* :@* :`*`(|*;   "   7 `i",*`:*`:@7i"''쀢 `'(ap"(ib"!pi""7* :`*`: _(!p'i"`i""" 쀢 B(@"!p"2 7* :`*`: "*`: *@* :`*`:@*`: *`(Ԑ  4   7耢 "' "   7@Wg " 㿐i" ` * :` אb@ai"8*`: (!` b""b ""b@""㿐i" ` * :` אb@5i" i"8*`: (!`(a"!i "  "!㿐i" ` * :` אb@ i"8*`: (!` b ""b ""b""㿐i" ` * :` אc@i"8*`:  (!` " B(!`  " 3 &h (!  d@`0, &h (!  d@  @`0, &h (!  d@  @`0,cH"#H㿀i" ` * :` אc@|#H a Ki "$@ *`:#\#` d   ?@Ui$*;  +  *# c@ "#i "$@ *`:c:*`:c:*`: c @*:#\( c @*:#` c ?@U "  @Qh   * :א @㿈i" ` * :` אc(@ `ג8" ` * :` 3*`_ ~8~~~~~X~~~~~~H~~~~x~~h 7 7 7 7 7  7אc@@ƽ 7* : @<㿐i" ` * :` אc`@Ʀi"8*`:  i( a @2"i 2"㿐i" ` * :` אcp@Ƅ ` " `@Ƌx/i" ` * :` אc@f ` " #!ܕ*`: ` @ƶ'䀢   @|@Ʋ h/#H h 2 (`2!^@WZ *`:*@*`"*@'#a2!*!`@{' u`@#!ܕ*`: !i"8*`:  iiib8 2"8(a"!i"8*`: (a"!"i"8*`:  iiib8 2"8(a"!i"8*`:  ((a"@ "!!'쀢 i"@`'(ap"(a"!p"!@  " 㿀'D'i",*`: iiib, 2",( Ԑ `  " ~(  Ԑ@ *`:   : 7i",*`: i",*`:*`:@Ÿ i",*`: i",*`:*`:@l7* :`  77* :`*`: q(!p'D!`D"!쀢 W(@"!p"2 7* :`*`: 7i",*`: *`: *@* :`*`:@g*`: *`(ؐ  4 *`: *@b2b2   7耢 "' "   7 " iiib, 2",B"*`: ;i"'쀢 `*`:"* :@D"!'쀢 (!p'D"!쀢 (@"!p" 2 b2  *`: C `> *`2 *`2 1Dib,2b,*: *(D@ @ "! Dib,*: *(D@ @ "!DDa2!DD! a  "  "  `"H*`:  D!`Da" @S ` ` 2 "H*`: ib" @R㿐i" ` * :` אc@@Ri" `@* :` אc@x '쀢 אc' *`:   *`: `'!c'`:'' *`: ! '`' * : @*`:  ܐ`$'' *`: `ܒ '`א@@k`'אc@^㿐i" ` * :` אc@O# 2!#2!܁㿐i" ` * :` אc@9 , :`*`# , : *# @  , : *#@ "  , :`*`#  " 7"*`: b*: * *#@ `"  , :` , : * *#@ `"  cH "#H㿐i" ` * :` ؐ`@½i"8*`:  " 9 ` " /((a(a "`@   @( *(("@ (a*`((  (a*`(( @t㿐i" ` * :` ؐ`@k#H @ " @  *" - `cH"#H# 2!#2!cH "#H `"H*`: @x `S㿐i" ` * :` ؐ`(@cH"#H㿐i" ` * :` ؐ`8@ cH "#H㿐i" ` * :` ؐ`H@i"8*`: (!` b@ "" ? @ ""㿐i" ` * :` ؐ`X@2"HH? @ "#H@+@㿈i" ` * :` ؐ`h@i"8*`: ( !@ *`:   @7) 7b* :` 7#H h  * :`*`:@+n)2 㿐i" ` * :` ؐ`x@oi " `  i " `  " L#H @ " @  *" 9@ 4`"!(c"#xiiib, 2",*:`?(`"!i",*`: (`"#x(c"#x@$'c" @P㿐i" ` * :` ؐ`@i"8*`: 3(a    ! b ""? @ ""? @ "" " b ""㿐i" ` * :` ؐ`@i"8*`:  ? @ ""(!` b "" ? @ ""㿈ؐ`'i" ` * :` ؐ`@"*`: "7i"8*`:  ( !@ 77*`:"H* :@ " <* :`*@*`  F a* :` ؐ`'* :`*@*`  F @ * :` ؐ`'#* :**㼖 ؐa@㿐i" ` * :` ؐa@#H ` #H @  !" @  `* :`  ." 3i"8*`:  (( a @*!\ " ( !\*`:  ( !\*`:  "  `cH "#H㿐i" ` * :` ؐa@b  ""i"8*`: i(a""(ib"!t㿐i" ` * :` ؐa @cH"#Hi",*`:  (( `Ԓ @2!i",*`:  ( `ؒ @2 (a2 i",*`:  ( `ܒ @2#~(a2#~㿐i" ` * :` ؐa0@Ab""㿈i" ` * :` ؐa@@-`@'쀢  i`@ " i"8*`: i H @ (a"i X @ ia2i X @ ia2(#$*`: ((c$2#$㿐i" ` * :` ؐaP@i X @ ia2i X @ ia 2#H h  #*`: 6 (( c *#(( c*#cH"#H㿐 " 㿐i" ` * :` ؐa`@i"8*`: (!` H? @ "#HcH "#HcH "#H㿐i" ` * :` ؐap@k#H ` #H @  !" &i"8*`: (!` (( c*#(( c *#(( c*#cH"#H㿐i" ` * :` ؐa@&#H ` #H @  !" &i"8*`: (!` (( c*#(( c *#(( c*#cH"#H㿈i" ` * :` ؐa@#H ` #H @   b* :`  !" E#H @ :#\#`      @LIؐa@ !Ր `@* :` ؐa@ؐa@ؐa@ !Ր ` * :` ؐa@ؐa@ؐa@㿈i" ` * :` ؐb@u ` " `@'쀢 (`@VcH "#H " 㿐i" ` * :` ؐb(@B#H ` #H @  !" 3  `* :`  ." &i"8*`: (!` (( c*#(( c *#(( c*#cH"#H㿐i" ` * :` ؐb8@#H ` #H @  !" 3  `* :`  ." &i"8*`: (!` (( c@*#(( c *#(( c@*#cH"#H㿐i" ` * :` ؐbH@#H ` #H @  !" 3  `* :`  ." &i"8*`: (!` (( c*#(( c *#(( c*#cH"#H㿐i" ` * :` ؐbX@L#H ` #H @  !" 3  `* :`  ." &i"8*`: (!` (( c*#(( c *#(( c*#cH"#H㿐i" ` * :` ؐbh@#H ` #H @  !" 3  `* :`  ." &i"8*`: (!` (( c*#(( c *#(( c*#cH"#H㿐i" ` * :` ؐbx@#H ` #H @  !" 4  `* :`  ." 'i"8*`: (!` (( c*#(( c *#(( c*#cH "#H㿐i" ` * :` ؐb@Ui"8*`:  ( a @* (( c*#cH "#H㿐i" ` * :` ؐb@-#H ` #H @  !" 'i"8*`: (!` (( c@*#(( c *#(( c@*#cH "#H㿐i" ` * :` ؐb@#H ` #H @  !" 'i"8*`: (!` (( c*#(( c *#(( c*#cH "#H㿈i" ` * :` ؐb@ ` (#`A ``@'쀢  (`@{ " n(cؒ@l(c#?@("c(#`ؐb@rRiib? 2"7i"8*`: (!` iib? 2" ii @ 2"i"*`:  ii @ 2"iib? 2"i"*`: ؐb@ؐb@㿐i" ` * :` ؐc@i"8*`:  " (!`"!#H h @Hi" `@* :` ؐc@!Ѐ`x(a           @ " h"*`: ,b*: * *#@ ( a @2 Db*: * *#@ b*: * *㼒@ `F2 F(a"!("!T#H h @H]i" `@* :` ؐ(a@](!` (!aЀ  " ((a"!T㿐i" ` * :` ؐcH@5i"8*`: (!` H? @ "#HcH@ "#H㿐i" ` * :` !i"8*`: (!` (( c*#(( c *#(( c*#ؐcX@㿐i" ` * :` ؐch@#H ` #H @  !" W  `* :`  ." Ji"8*`:  (( a @*!l " ( !l `      ( *!l( *!l ( *!l "  `cH "#H㿐i" ` * :` ؐcx@g#H ` #H @  !" @  `* :`  ." 3i"8*`:  ( a @*  "  ܕ*`:   ܕ*`:  "  `cH "#H㿐i" ` * :` ؐc@ ` ` *`: s *#` *`: g*# "  " 㿐i" ` * :` ؐc@ ` ` *`: s( *!`` *`: g(*!` "  " 㿐i" ` * :` ؐc@#H ` #H @  !" 5  `* :`  ." (i"8*`: (( a @*#i"8*`:  (( a @*#cH"#H " 㿐i" ` * :` ؐc@Jb ""㿐i" ` * :` ؐc@6i"8*`: -(!` b ""b""i"8*`: (!` b ""b ""b""㿐i" ` * :` ؐc@i"8*`: -(!` b ""b@""i"8*`: (!` b""b ""b@""㿐i" ` * :` ؐc@" @  ? @ ""Hiiib8 2"8*:`?6cH "#Hi( a @2"(iiib8 2"8*:`?cH "#H( a @2 i"8*`:  (( a @2!hb """ @ ؐc@Iِ`@C㿐i" ` * :` ؐ`@4i"8*`:  " 6 ` " ,((a "!`@x   @:( *(("@ (a*`((  (a*`(( @㿐i" ` * :` ِ`(@i"8*`:  (!`( "!i" `@* :`  ( !@ *`: ِ8@( !@ *`:  @@D㿐i" ` * :` ِ`P@"*`: 2"b*: * *"@ *`"L b*: * *" *L@ a[*![b*: * *"@ *`"L b*: * *" *L@ a`2!`i"8*`: H(!`"b*: * *"@ *`"L b*: * *" *L@ a` 2!`!b*: * *"@ *`"L b*: * *" *L@ `? @ 2!` b*: * *"@ *`"L b*: * *" *L@ a` 2!`㿐i" ` * :` ِ``@"*`:  @I0㿈i" ` * :` ِ`p@"*`: 2"i"8*`: ( !@ "i"8*`: ("! "@ *`:( a @*:`( a @*:`#\#`   @C.i2"8 `(!` "*`:  @x7i" ` * :` ِ`@w"*`: 2"77i"8*`: / "@ *`:( a @*:`#\#`    @B `  !ו*`: ِ@A(a@ a*?db*: * *"@ *`"L b*: * *" *L@ a` 2!` `@7* :` U* :`  * :` A "@ *`:*`:#\#`    @B~ `.* :` *`: !ו* :@* :`@ a*?  7* :`  @*`: 7  7* :` * :` * : * : * ;  * ;` * 8 #\* 8 #`ِ@* :` `ِ`@ @*`: ِ`@z *`: ِ`@o *`: ِ`@d *`: ِ`@Y *`: ِa@N *`: ِa@C *`: ِa@8* :` `ِa@- @*`: ِa @" *`: ِa(@ *`: ِa0@  *`: ِa8@ *`: ِa@@ *`: ِaH@* :`  * :` ِP@77 @=e㿈i" ` * :` ِa`@"*`: 2"i"8*`: kb*: * *"@ *`"L ( a @*!U"H*`: O "@ *`:b*: * *" *L@ a\*:`b*;  * + " *"L@ a]*:`b*;` *@ +`" *bL@ a^*:`b*8 * ("*L@ aU*8#\#` M @@"*`:*`*"@ *`L !U*`: ِp@9㿐㿐i" ` * :` ِa@'"*`: 2"b*: * *"@ *`"L b*: * *" *L@ a` 2!` #L  7*`t ҰՈՈՈՈՈՈՈՈՈՈՈՈՈӠՈՈՈՈԐՈՈՈՀՈՈՈՈՈՈՈՈ$ՈՈՈՈՈՈՈՈՈՈՈՈՈՈՈՈՈՈՈՈՀb*: * *"@ *`"L b*: * *" *L@ a`2!`b*: * *"@ *`"L b*: * *" *L@ a`2!`b*: * *"@ *`"L b*: * *" *L@ a`2!`b*: * *"@ *`"L b*: * *" *L@ a`2!`Eb*: * *"@ *`"L b*: * *" *L@ a`2!`b*: * *"@ *`"L b*: * *" *L@ a` 2!`  " i"8*`: b*: * *"@ *`"L ( a @*!Xb*: * *"@ *`"L  Z*!X㿐i" ` * :` ِa@"*`: 2"b*: * *"@ *`"L b*: * *" *L@ a` ;2!` #L  7*`uT 4             $               ب             ٘    ڈ   b*: * *"@ *`"L b*: * *" *L@ a`2!`b*: * *"@ *`"L b*: * *" *L@ a`@2!`b*: * *"@ *`"L b*: * *" *L@ a`2!`b*: * *"@ *`"L b*: * *" *L@ a`2!`Eb*: * *"@ *`"L b*: * *" *L@ a`2!`b*: * *"@ *`"L b*: * *" *L@ a`2!`  " i"8*`: b*: * *"@ *`"L ( a @*!Wb*: * *"@ *`"L  Z*!W㿐i" ` * :` ِa@e"*`: 2"b*: * *"@ *`"L b*: * *" *L@ a` 2!` #L  7*`w ݸިߘ, b*: * *"@ *`"L b*: * *" *L@ a`2!`b*: * *"@ *`"L b*: * *" *L@ a`2!`b*: * *"@ *`"L b*: * *" *L@ a`2!`b*: * *"@ *`"L b*: * *" *L@ a`2!`Eb*: * *"@ *`"L b*: * *" *L@ a`2!`b*: * *"@ *`"L b*: * *" *L@ a`2!`  " i"8*`: b*: * *"@ *`"L ( a @*!Yb*: * *"@ *`"L  Z*!Y㿐i" ` * :` ِa@"*`: 2"i"8*`: (!` " ("! "@ *`:( a @*:@I㿐i" ` * :` ِa@"*`: 2" "@ *`:  @I 㿈i" ` * :` ِa@"*`: 2"i"8*`: b*: * *"@ *`"L ( a @*!Zb*: * *"@ *`"L b*: * *" *L@ a[ ;*![b*: * *"@ *`"L b*: * *" *L@ *;  * + " *"L Z*Ⱋ+ ;` + @ +`# + bL Z    a[ @ *![i"8*`: b*: * *"@ *`"L ( a @*!T"H*`: @ "@ *`:b*: * *" *L@ aT*:`#\#`    @;y "@ *`:b*: * *" *L@ a[*:`#\#`    @;Z"*`:*`*"@ *`L !Z*`: ِ@㿈i" ` * :` ِa@"*`: 2" ` i" `Y ``@'쀢  i `@s " ia ْ@dia !?@i"b i" `ِb@jb*: * *"@ *`"L b*: * *" *L@ a`? 2!`i"8*`: H(!`"b*: * *"@ *`"L b*: * *" *L@ a`? 2!`!b*: * *"@ *`"L b*: * *" *L@ ` @ 2!`V"*`:*`*"@ *`L !`*`: #b*: * *"@ *`"L b*: * *" *L@ ` @ 2!` b*: * *"@ *`"L b*: * *" *L@ a`? 2!`"*`:*`*"@ *`L !`*`: ِb(@|ِb@@v㿐i" ` * :` ِbX@g"*`: 2" "@ *`:  @@㿈i" ` * :` ِbh@E"*`: 2"i"8*`: b*: * *"@ *`"L ( a @*!\b*: * *"@ *`"L  *!\"H*`: O "@ *`:b*: * *" *L@ a\*:`b*;  * + " *"L@ a]*:`b*;` *@ +`" *bL@ a^*:`b*8 * ("*L@ aU*8#\#` M @9P㿈i" ` * :` ِbx@"*`: 2"i"8*`: b*: * *"@ *`"L ( a @*!]b*: * *"@ *`"L ?*!]"H*`: O "@ *`:b*: * *" *L@ a\*:`b*;  * + " *"L@ a]*:`b*;` *@ +`" *bL@ a^*:`b*8 * ("*L@ aU*8#\#` M @8㿈i" ` * :` ِb@"*`: 2"i"8*`: ( "!C "@ *`:#\#` N    @8 !Ր `* :`  ` !ؕ*`:  !ٗ*:  !י*;  ِ"@(!` ( !@ *`:  @4M!i&&ch&ch " &ch@  & ch @"@ `4"8㿐i" ` * :` ِb@㿐'`"#"*`:  b*`:"H* :@ "  P" ` 2 `b2 @8U x"`  " ("c  " i" `* :`  @`b" 'ِb@/' `  @4]`" ( c @4O(*; c"@ " (`*:"# @57 `#@`. *ِ`@'` *`:쀢@a *`: ِ@`'ِb@#@`0c@ "#@ '*` '` *`: c@ "#@ '*` 'ܐ`' '&"#` "&h@ Z* :` . * :` x* :` ^*; `"@ " `'D* :`  * :` *; `@ " `'&ْ"@r'܀  @3k`'&#`` &#`` '܀ ` *`: ''` *`:쀢@a `*:"@  *: *`'8'` *`:쀢@+쀢 a  "@  *: *a `*:"@  *: *`''(# @ib@ @ @*`')(c " `" @3 *; `@ " QcH "#HPcH@ "#H#` ` #`  " (#c  ( c  "  c"  'i" `* :`  @Y` *`:*ِ@&'` *`:Ȁ@`Ȕ *@ *`: ِ@ Ȑ`'!Ѐ`(ِaT@c" ̀   `&@ (@"# ("# (# "@'@3  `'' `'''(# @ Ȁ@@' `  Ȑ@ " ِ(@ ' /ِ(`@  ِb@Ē 'Ē@ *? ِc0@Ē 'Ē@ *?'"  /Ȑ`'* :` ِ8@`* :`  * :` ~ ./Ē 'Ē@*?Ā  Ē 'Ē@ *?Ē@*?Ȓ `ِb@1(# @ Ȁ@IȒ``:` *"  "@' 4' ِc0@ Ē 'Ē@ *?`' ِc@@Ē 'Ē@ *?ِb@ 'Ē@*?Ȓ ` ِH@'' (` @ " H? @ "#Hx 7#H @ H? @ "#H2"Hi" `@* :` ِcP@@%."` `ri" `@* :` ِcp@cH "#Hi! b* :` cH "#H(( c *# #*`: (( c*#7*`:"H* :@** :`*@*`@'`F 2 Fi! d* :` * :`( c*`:#\#`    @3* :`( c*:`#\#`    @3 #*`:  H? @ "#H ` aג *`: *#L@ "  F `* :` -2 H2 J`F2 F !ו*`: ``2 J P `2 J P 2 H P  P@ `F2 F ` &"  ` i" `@* :` @/ِc@`"  `'`"  @*`: * *"@ *`"L *`: * *" *L@ aT*!T ``" @` " " * :`#\#`     @2 `7i X @ ia 27* :` *`:*:! *   7 *`: 2 *`: .`F2 F *`: 1`F2 F *`: 7  *`: .! *`: . *`: 1(( c@*# aۓ*:`2 L`F? 2 F *`: 5 *`: .b ""`F 2 F7cH"#H *`: 7 *`: .cH  "#H *`: 6 *`: ." i! `* :` (( c*#X *`: .Qi X @ ia 2i! `* :` (( c*# *`: 7 *`: 1 *`: a  *`: A"  @"  @" "  *`: :`F 2 F  7i! d* :` #H @  !" c|*`:"H* :@ %" bH2#| ``ْ@I` #,%#H @ H? @ "#H` *`:*``ْ@$` #7*`: * :@*`: * *" *@ a"  `@1  7ib" @1i" `@* :`  @ `i* :` :" @ 3i! c* :` +7*`:"H* :@* :`( c*`:#\#` $   @0  7cH "#H( #*`: #\#`     @0H7 @ "#H@ *`:  #H ` @@㿀#H @ 1i"(*`: %*`t L, (( c *#( #*`: #\#` ?   @0}(( c*#( #*`: #\#` ?   @0i(( c*#( #*`: #\#` ?   @0U(( c *#( #*`: #\#` ?   @0C(( c*#( #*`: #\#` ?   @01(( c *#( #*`: #\#` ?   @0(( c*#( #*`: #\#` ?   @0 (( c *#( #*`: #\#` ?   @/}(( c*#( #*`: #\#` ?   @/(( c *#( #*`: #\#` ?   @/ @+(( c*#( #*`: #\#` ?   @/B(( c *#( #*`: #\#` ?   @/(( c*#( #*`: #\#` ?   @/ @+(( c *#( #*`: #\#` ?   @/ " #H @ S *`:  (( c *#(( c *#(!h*`:  (( c*#(( c *#( # ` `( #*`:  *`: #\#` ?  @/8( #*`: #\#` ?   @/)(( c *##H ` + *`: ( #` * :`( #*`: #\#`  $  @/( #*`: #\#`  $   @.#H @ b  `* :` Z( !\ `* :`#\#`  4 ? @.( !\ `* :`#\#`  4 ? @.( !l `  `#\#`  4 ? @.( !l `2  `  `#\#`  4 ? @. ܐ `  `#\#`  4  ~ @. ܐ `2  `  `#\#`  4 ? @.H) @ "#H7*`:"H* :@* :`*@*`  F @ * :` z* :`*`: * *" *L@ aT*:`#\#`    @.N* :`*`: * *" *L@ a\*:`*`: * + " *"L@ a]*:`*`: *@ +`" *bL@ a^*:`*`: * ("*L@ aU*8#\#` M @. * :`*`*"@ *`L !` `* :` * : @4  7fx` \ `* :` "Dct "D` #t` " ("Dc  (#tc  " i" `@* :` "ِ#bDt@ !Ā`ڐ`@i" ` * :`  @#tbD"  'bD" i""4耢   `!'䀢  '?'@ )@" )" ) 䀢@ !)#))  @ `"@$ ) "@'') @;'䀢 -  i@ܖ" "  + ; *  i@"  *: * `' '@))`@ " w `i" `@* :`  iiڐ b44@I#H `  ``\ 2 \@h ''"H*`:쀢@*@*`@' F `* :` i" `@* :` # @`  8 `ڐ`P@ڐ`x8@ @`ڐ`<@ *`: 4v @`q 0`4 ji" `@* :` ڐ`@(( c*##H ` * :`( c*:`#\#`    @,G !ו*`:? $" * :`( c*:`#\#` $   @,*cH "#H* :` * *㼒@ `;*:`#\#`    @,H? @ "#HP" ` 2 `2 @,V 0`4   '`"   4`0"  '`0" i""4䀢   ` @'?'  '?'@ )@" )" ) @ !)#))  @d`"@$ ) "@'') @;' -܀ ܐ i@ؖ" ܖ"  + 8; * ܐ i@ܖ"  *<: * ܐ`' '@(@)`@ " t `i" `@* :`  iiڐ b44@#H ` `F 2 F`'c" 㿐/㿐㿀!Ȁ`!cx  #x` " (!c  (#xc  " m`#?@'耢 ^#xaȐ"  'i" `@* :`  ڐ`@3a" 쀢 9@ (@"# ("# (# "@'@(I `( @6'䀢  "  (` @ " @^ " 㿀 `(!|`(!|`  ` (!X` " y( c ((!|c  ( c  " ]i" `@* :`  (ڐ`|@(!|`"  ''`" 쀢 S@ (@"# ("# (# "@'@' `/'(# @$" a a *`:@' a *`:@'`' (` @ "  ``" )(aX" " a " b 8' ' " b 8'i" `@* :` R(!X * ڐ@(!X`" @ ڐa8@ڐaP@" a ڐah@" b ڐa@ڐa@ڐa@" b ڐa@ڐa@" @ '(!X@ib@  *: *`'(!X'䀢 (!X" i@ *: * 'i" `@* :` '(!X@ib@ *`: ڐ@V`'@%x' ''"H*`:耢@$*@*`  F `* :` i" `@* :` * :** + *㼖 ڐ" $@ P" ` 2 `2 @( `*@*`  * *㼒@  $` "  ' \@ (@"# ("# (# "@'@% `8'(# @-*@*`  F `* :` a *`:ܐ@' a *`:ܐ@'`' (` @ "  `\ * *㼒@ `(" ) * *㼒@ `," *@*`  F `* :` *@*`  F `* :` ܒ8'ܒ '*@*`  F `* :` ܒ8'i" `@* :` |)  * ڐ@*@*`  ,`*@*`  F `* :` ڐa8@ڐaP@*@*`  F `* :` !ڐah@*@*`  F `* :` ڐb@@ڐbX@ڐa@*@*`  F `* :` ڐa@ڐa@*@*`  F `* :` $'*@*`  ,@ib@  *ܓ: *`'-*@*`  ,'䀢 *@*`  ," i@ *ܕ: * 'i" `@* :` $'*@*`  ,@ib@ *`: ڐ@+`'@#" `'㿈(# `i `i( c  !` " ((# c i( c  (!c  " fi( c "  'a" (c " 쀢   `J@ (@"# ("# (# "@'@# `!'(# @ib@ @ @*`')(c " @# )`@ " (` @ " x"a̐"  'a" ''耢   `@ (@"# ("# (# "@'@#} `z'(# @q' @< 'M * :` *`:  (# @ @ '쀢  @ ?'''`'܀ '쀢 #ڐbp@' @cM *`: ڐ@`''(` @ " [p"a̐"  'a" ''!(c@$ (#'耢   `@ (@"# ("# (# "@'@" `f'(# @]' @> 'aԖ`' * : @*`:  (# @ @ '쀢  @ ?' ''(#'`'܀ 쀢  (ڐb@&'(#'(` @ " o㿀77* :`*`:#\#`    @$㿀/#H @ @@(( c *#i! d* :` cH "#H( !`*`: H? @ "#H(( c*##H @  / #*`: 5#H a cH "#Hi" `@* :` ڐb@  @ * :`  # `* :` !["L@  c * #*`: #\#`     @$#H a #H @ (#` (`*:"#(#c@}ib$*: * *㼒@ ` ib$*: * *㼒@ ` '"H7* :` 1* :`( c*:`#\#`    @#* :`*`:i b* @*:` b@ @*:`#\#` D @#? 7"H7* :` i*`:"$* :@zi" `@* :` P* :ڐ@ڐc@#H @ ڐc @(ڐ0c@* :`  i"**`: ڐH@ڐch@ڐc@"@*`: ڐc@ "@*`: ڐ@i "$@ *`:2*`:2*`:*`:#\) ` @*:#` # ?@#* :`) ` @*`:#\#` #   @"? 7_/"H7* :` #* :`( c*:`#\#` $   @"* :`#\#` #    @"? 7 `@"2"H@"`㿈  @1((a^*: * *" * " p(pa" ib" @"(pa" (@" 0i" `P* :` (ڐ`p@i" `* :`  @ (`p! `* :` (`p @7'쀢  " (`p @&'쀢  " (`p!*`: ((pa " (`p!`( pa @  " !)(i@0@$ ` & d*`: (`p! `* :` (p a ) ` (pa (p a  )`@ " ) ` (pa )(p  a"@  *`:" (p a 6))(p " `"@ " 7* :`)` * :`i@*:( p  " i"@ *   7(pa " ((pa"  ()`@ " @g ` )`@ " B(( `@0) ` " i" `@* :` ې`@()" ((&2d"`P" @& * f!(((`0@$#`mi" `* :` E(((0? #" ېc@7* :` +(`p!*`: * :`) * :` ې@@f* :`) * :ېH@X  7ې`P@N((c@ (0"@ "#(`p!*`: @]@: `) `@()`@ " (( `@/ `@ i" `@* :` ې`@@p㿀()" (#` ` & d*`: g((` " (#'7'耢 i(` /* :`  * :` C  7( `" *@(((c "#`'(` /(#`8* :`  * :` (((`  " (((c "#`'`'(((`  " (((c "#* :` :i" `* :`  (ې`X@Y()" '耢 (`  "` (`"` *`'(@"@ " 0((` " 쀢 2i" `* :` (ېp`@((`"!x( `"  @?ߕ*`: R{*` W8WLWLVWWLWLWLWLWLWLWLWLWLVWLWLWLWLWLWLWLWLWLWLVW(WLWLWLW8WLWLWLWLWLWLWLWLWLWLWLWLWLWLWLWLWLWLWLVWLWLWLWLWLWLWLWLWLWLWLWWLWLWLWLWLWLWLWLWLWLWLWLWLWLWLWLWLWLWLV@A+@'%@&!@@T@V( " @( @`@ #" &(ax" `(#` ()" (@" 0㿈 @7 @'" `@ *(!x`*`: * *`:@(*`: *` !x  @, :* :@ " G @* :`    (   ( P@'7(" P!( @* $ P7!( @* $ P77* :` * :@㿈" `@ !(!x  @U7(!x`*`:` *`*:@C* :`  " K( `"  @* :` 2 2 1  3  7  7  77* :`  @N*`::`2@ : " 7* : @;'* :@~㿈(` *`: /_ @&' @"7* :` Q" `@ @(!x  @Q(!x  @, :* :@%(!x` *`: **`:@6(*`: *` !x  @, :* :@ "  ((`" * :@㿀7' @7" `@ (*`:!x@$(!x  @n, :* :@ " ( `"  @* :` 6 6 31} 8rx((`" ( `"  @* :`7* :`  7* : @o(`P'? " 7S((`"  @[7* :`  7 7* :`*`:  @A7 @=7* :`  7* :`  * : @"("`P7 7(" P& 2 d7* :` * :`: 2` :`7* :@H㿐 " 㿈 @7" `@ *(!x`*`: * *`:@(*`: *!x@    @, :* :@ "  @'* :` * :@㿈( @` @'( P'(`@R7(` *`:  (((` " ? 7* :`( *`: , ; ( " @? 7 ( " @? 7(*`::`2@ :*`: " P* :` * :`: 2` :`* :@㿈'D7'7* :`*`: D 'D @@' 7D`'D *`:㿈'D7'7* :`*`: D 'D @@' 7D`'D8   *`:㿈'D7'7* :`*`: D 'D @@' 7D`'D* :`㿈'D7'7* :`*`: D @j@'  7D`'D *`:㿈'D77 7*`:`*`:D@ @*: *%`@  7` 7 7*`:*:@ *`:D@ @*: *%`@  7` 7 `*: 㿀'D77'*`:*:@ ,*`'*`:D@ @*:#x @  * * *#*; D + ;`@ @  '`7㿀7(`'7'*`:*:@ ,*`'*`:@ @*:#x @  * * *#*;  + ;`@ @  '`7((*;  "`㿈'D7i" `* :` (`pD!@* :`ې`D@(`p! `* :` `(`pD! @* :`D (pa  (`pD!@i" `* :` ې`@@* :`D (pa  (`p!F"@  7(`pD! @(((p D"  *`@ " (`p!F"@ " 7(`p! 'D(`pD!@'DD  * :`D  (D#@ " D ((D  *`@ " F 7'D& f ` * :`D `" @  ) ` D@4& f `  &* f(i@" (D" ) ` D@()`@ " (( `@((D" @)" D" 7* :`*`: ,(` "`( @*:#x @  * * *# (` + ;`@ @ *  7((`" ))*:`@ "  `G `Bi" `* :`  " ` (ېax@(`pD!"@* :ېD@" ` " D"#p((pDa" "!i(`p""c<2#<㿀" ` ()`"# `" @ `  `''(# @_ib@ @ * : @*`: H @i@ *:  *;  ې! @+`'  @z %ېaH@&ch@f/* :` y* :` * :`   '"  '`'(i@" @n(i@"  `(&``"!x㿐 " x7 *`:  "H*`: ېaX@#H @ ېax(@i! c* :` f#H @ ېa@ېai@" @ ېa@" ` ېa@ېa@i! d* :` ېa@ti! b* :` ېb@hېb@b#H b (!*`:  *: #~*: ې" @Li! b* :` 1#H @  iېP`@7 iېbpi@-i! `* :` ېb@!i! `* :` ېb@ېb@" @ ېb@" @ ېc @" ` ېcH@ېcx@" ` ېc@" `@ ېc@"@ @ ܐ`@ܐ`@@#H a ܐ``@ *`: ܐ`@7*`:#|* :@* :`*@*`@' F a* :` ܐ`' F @ * :` ܐ`'ܐ`'* :` 8#\ܐ` `@k F a* :` A H*`:*`: /ܐa@U L `* :`  F @ * :` ܐa@@ܐa @: L `* :` ܐa(@.  H*`: ܐ0@$  7p!Ѐ`ܐ@a@ *`: L *`: ܐah@#H ` ܐa@" @ ܐa@7*`:#|* :@o* :`*@*`  F `* :` V* :* :** * :+ *㼖 ܐ!04@* :`*@*`c * :** ܐ`@8@* :`*@*`  @`* :`*@*`c ܐ`<@x  7!ܐb@lܐ0bDt@dܐa@\!Ā`ܐ`@Q#H ` ܐbP@G" h ܐbx@=7*`:#|* :@* :`*@*`  F `* :` o* :* :** * :+ *㼖 ܐ! $@* :`*@*`c * :** ܐ`(,@* :`*@*`  F a* :` #ܐb@* :`*@*`  F b* :` ܐb@ܐc@ܐc @  7p6ܐcH@(ܐ0`|@(ܐ`X@" a ܐb@" b ܐb@ܐc@zܐc @t7*`: * :@* :`*@*`"*@'* :` ܐ`@Pܐcx@L!*`:  59 !*`: S S  : ; sܐc@%ܐc@ܐc@ܐc@ܐc@ ܐc@ܐa@ܐa@! `* :` ܐc@! a" ݐ @!a" ݐ8@!` aݒH@eݐ`p@  7R *`: i"`ݐ`@ibݒ@Ai"*`: ݐ`(@& `+ݐa@7* :`&` * :`* * :+ !$ݐa(@  @s  7㿈'D'H7D *`:*`ݐa8H@\!Ѐ` ((ݐPaTT@Oݐap@KDݐa  @DD 4ݐa@:7D*`: * :@D*`: *@ *`: ݐ@  7DDݐ`@D'D㿐 `,"  ` `/  `ݐ`@ݐb@t ` *!!ݐ"8 @ *!!ݐ"8 @(!x` (ݐPax@("!xi" `* :` 1i ` iݐh`@i" i"` iݐb@i""#< `* :` (ݐcp@c< 2#<&#``ݐb@&"#`cH  "#H ` H? @ "#H#H ` " ( "!t㿐i"*`:  (i#0@ki" `* :`  ݐb@2ib0@8ib0@"` ` # ` * :` @  㿐@ "` `i" `* :`  ݐb@(c@i"*`:  ((#@  ` !Ր `* :`   aח*: "  hiib4@ ""4i" `* :` ݐc@i" `* :`  ݐb@"c@` *`:'" `   #V@  * #V@  !*# @''' 4c@'䀢  `''"ؒ@'!  *`:ؒ  @*` `,#V' #V*`:*@*` * :` 4 #H @  '쀢   `쀢!!''" ' #V@ * ' ''耢  cVܐ  @*" `   *`:Ԑ@' 'ܐ`'i" `* :`  ݐb@cV@i"*`:  (cV@#H @ %" @  #*`: 8 #*`: 0 !"  cV@c"`<cV@d"` `0" ` *z"` `!Ѐ i" `* :` Ԓ ݐ@k !ו*`:ו*`:  " i" `@* :` @ @[# `  ؐ`' x'D'HD /* :`*@*`  ' 'H   `1* :`:*`::*`:*`:#\#`  @* :`D@ @*:`#\#`    @`'`'*`: * *#@ "  `iib4@ ""4` *`:'# @' #@  * #@  *i ""0'' c@'䀢  `''"ؒ@'!  *`:ؒ  @*` `,#쀢   `#H @ " @  #*`: 8 #*`: 0 !" n #*`:'Ԕ*@*`  ''쀢   `Eד* :`Г:*`:Г:*`:ӕ*`:#\#`  @ד* :`#\#` G    @ a* 'ܒ `i" `@* :` @ @ܐ`'А`'Ԗ * *#@ " ':쀢!!'' #@ *"` `!" ' '`܀@ܒ@ @* 'ܐ`'i" `@* :` @ @  ` (ؐ`'i" `* :` ݐc@i" `* :` "c@ 㿀#D'@"` ` #H `@ @ "` ` E2"H2 Z'"H*`: +@w @i! b* :` '(#$*`:耢@ @ @ `'/ @ @ (#*`:  @ O (#$*`:*@쀢 `' @o @ {ݐc @* :` (#$*`:*@쀢 @ '* :`  (#*`: (#*`:   ' ] @ @ @   (#*`: (#*`: : @* :` )* :`  (#*`:  @  (#*`:  * :`  @ @ @   (#*`: (#*`: * :` *`:2"H* :`   㿐@(#`(c@m 㿐㿈'D'H'H 4D 'D * :` ݐ(@~`' ` i" `* :` ݐb@~ݐc0@~  ``#H @ #H@ @    @~i`"  ݐcH@~ @~ 2 h(b@~"`` `  l@ @~'@  `h 2@ݐcX(@~nݐch@~| @~ݐc@~ci`h @~_  ݐc@~g @~' @ * :` V !@ @`' * :` W y@ @ @c * :` > @M  @A  r@p @mi`@~Z耢  ݐc@} @m ݐc@} @dސ`@}   @}i`"  ސ`@@} @~ 2 h#H@ @ 0(b@}"`` `  l@ @}'@  `h 2@ݐcX(@}ݐch@} @} '@ `h 2@ސ`P@}}i`h @}y  ސ``@} @}ސ`p@}hi! c* :` <ސ`@}\   @}xi`"H  ސ`@}_ @} 2 h'@ `h 2@ސ`P@};i`h @}7  ސ`@}? @}ސ`@}&i`В  @}'쀢? Ni` В @}}? A#H a  i "*@ *`:  @y, 7i! b* :` #H a #H @ i` #  $)`"    /# / / / /iސ`@| /i $ @ "iސai@|i` @|i`"  i`В  @|'쀢? i` В @|? i @|`  77Ǔ* :`77ΐ /Ր /i @|G  z@z#H a @r@p@n7i! c* :` Dސa@i@|'i`ؒ @|i`"H  OcH "#Hi`x@|  ;  x@  "  x@  "i` x@{  !i! c* :` ē* :` @#H a @ @ @ 㿐#H @ Yi! b* :` #H a K#H @ Di" `* :` ސa`@{i`@{  (`" i`@{  ` " i`@{l  㿐#H @ i` @{i`В @{i`@{i`@{i! c* :` i`@{i! b* :` i`@{x'D'H @si! c* :` #H @ D /i! d* :` ߐ `*@*`  H*`: 2 Z 2 Zi! d* :` Sߐ `*@*`  F `@* :` C&* p&& `|* x#H @ &  p@ & `s *&  x@ & `{ *&  p@ & `s*&  x@ & `{*& `>i"*`:  (c&x @z#H @  i`&x @z&`x''쀢 ؒ ' * : @5`'@=i"*`:  (c&p @zi`&p @z@$& `\& `|*: * *㼒@ `H*: * *#@ & `|*: * *㼒@ `H*: * *㼒@ `F 2 F& `|*: * *㼒@ `J*: * *#@ & `|*: * *㼒@ `J*: * *㼒@ `F 2 Fߒ  * *㼒@ `H*: * *#@ ߒ  * *㼒@ `H*: * *㼒@ `F@2 Fߒ  * *㼒@ `J*: * *#@ ߒ  * *㼒@ `J*: * *㼒@ `F@2 F&* |& " #H @ 'H''iD@  @y'耢   @ '" 'H'H D 'D * : @%H''iD@  @y'耢   @ '" ' 㿀' @xi! b* :` i! a* :` #H @ v#H @ i`@* :` `ia @v@+ia @o'쀢 a  @ `' !֕*`: (!"# ( a֗*: `"# '(#@a  @Y `''' '䀢 @i@  @x'쀢`& ` '(c*:  `@(#*`:  r '" ' !֕*`: (!"# ( a֗*: `"# ' '(#'䀢 Ai@  @xf'쀢`' `  'a (#*`:  @g(#*`:   '" ' 㿈&& `|* xi! d* :` .#H @  i`&x @x&`x''쀢  ' * : @`'㿈'D(2# @w'(D@ " 㿈i ` #H @   @w'( 쀢@ ( 2# 㿈/i! b* :`  * : @0,i" `* :`  * :` ސh@wai Д @w i" `* :` ސap@wG㿈/i" `* :`  * :` ސh@w2 Z*`:  * : @jQi`@* :` `i*`:!@ia @@6ia @z#H @ i`@x* :` `ia @`@ia @Yi" `* :` ސax@v㿈'(!*`:쀢@`'㿈/i" `* :`  * :` ސh@vi`@' *`: i*`:!@ ia @ia @#H @ i`@ *`: ia @ia @i" `* :` ސa@v]㿐'Di! b* :` i`@* :` `ia @i`@D*`::` `*ia @i`@* :` `ia @ia @i`@* :` `ia @i`@DD* @ @ *ia @li`@q* :` `ia @Yia @Ti" `* :`  D *`: ސ@u    㿐'Di! b* :`  DW$"i`D @u i" `* :`  D *`: ސ@u  㿈'D/D*@㿐'DD *`:㿈7 @u㿐#H @  ``" ` ` @ސa@uW:`` "````:` *"    "  ސa@u1ސa@u+ސa@u%ސa@u㿐#H @  ``" ` ` @ސa@u:`` "````:` *"    "  ސa@tސa@tސa@tސa@t㿐ސa@t㿐㿈'DD *`: D 'D /* : '     㿐* 2 㿀' ') 'i" `* :`  )ސ`@tk䀢   ``"  耢`` @ @" `"  耢`g `  `" `"#"#` 耢@ ` ` `" @#` `"#i@@ ""7"`#@'#"@'#@'``@ " ``"@ "  " h㿀' '(# 'i" `* :`  (ސ` @s䀢   ``"  耢`` @ @" `"  耢`g `  `" `"#"#` 耢@ ` ` `" @#` `"#@ ""o"`#@'#"@'#@'``@ " ``"@ "  " h((c " "# x#H'H? @ "#H(( c*# '쀢   `]7*`: * :@K#H ` )*`: *@ *`:( c*:`#\#`    @] !ו*`:?  $" "#H,*`: *@ *`:( c*:`#\#` $   @6  7'``\2 \x` *`:*`'` '耢 " '`"@ " !` `" `*:@r4 7`*`: * :@x` `" `*:@ra*: * `*: * *㼒@ ` '!Ѐ` (#`(aT@r@'*`: * :@`'*: * `*: * *#@ " `*`: *@ *`::*`::*`:*`:#\#`  @t  7㿀 `cH "#H(( c *# '쀢 77*`: * :@%*`: *@ *`:( c*:`#\#` $   @- `  7'``\ 2 \㿈( #*`: #\#`     @㿈\`////////#H @ 8 `1* :`  " &#i*`:`""0. . . . . . . . "` -" 㿐 ` "`㿀"H*`: c|*`:"H* :@ "  ` ''쀢 y" 7*`: * :@`"H*`: *`: *@*`:"H* :@ %" p*`: *@ *`:*@*`  @'*: * `*: * *#@ *: * `*: * *㼒@ @` " "   7" '("#`?" `" `(c" !Ѐ`!((#`a@pq?$#`(c" 㿈&"#`i2"(2 (2!h(?"#( 2!j(*#(*#(*#i"" "#Di""<( 2#$("!d2"H"!("!T2#|( 2! 2  2#~) 72  0* 2 (2!^i2"$i2"*2"@i"  "!("!t*#(*!`"#H""*"7* :` k*`: * *#@@ " *`: * *#@@ " *`: * *#@@ " *`: * *#@@ ?" *`: * *#@@ " *`: * *#@@ 2 *`: * *#@@ 2 \*`: * *#@@ *`: * *㠒 "  7+#@@ "(@"!p" i"" #P@ " #P@ " #P@ " #P@ ?" #P@ " #P@ 2 \#P@ 2 #P@ 2"#Pi2"&i"&*`:  @?iiib& 2"&i2"&(2!^(!^*`:  @O(((a^ 2!^i 2"7* :` * :`*`(("   7㿈i"&*`:*@*`@'" " " " " " 0" 4 " @ " 8 2 F*㿈(!^*`:*@*`"*@'2!"!"!"! "!2!"!*㿀ސb@n&2 &`*`:"H* :@&&`*: * *" *L " &`!` `* :` ((`** ((*`* &`& aT *!T&`!d*`: M&`& a[*![&`& a[ *![&  @ *`:#\#`     &  @ *`:& a[*:`#\#`    &  @ *`:   "&` 2!d&`&`&ab 2!b&  @ *`:& aT*:`#\#`    &  @ *`:& a\*:`& a]*:`& a^*:`& aU*8#\#` M  `,&`!b*`: '&  @ *`:#\#`     f&`2!b((*`* &`!` @ * :` ސb @m&  @ *`:#\#`  ?  A'쀢 (` @ @*`'(( `ʒ Đ @ (( `̒ Ő @&`!` @ * :` ( Ē ( Ŕ ( Ɩ ( ǘ `( Ț( ɐ#\ސ(@mb((( ` Ē@ ( Ē @ * ((( ` Œ@ ( Œ @ * (( `* (( `* &`!`*`:  ib (Ĕ @m`&`!` @ * :` {( ΐ ` `ސbH@m( ΐ ` `ސb`@m( ΐ ` `ސbx@m( А ` `ސb@l( ΐ ` `ސb@l( ΐ ` `ސb@l( ΐ ` `ސb@l( А ` `ސb@l( А ` `ސc@l( А `@ `ސc@l( А ` `ސc8@l&`!f*`: )( ̐ ` `&`2!f&`&`&ab 2!b( ʐ ` ` &`&`&aP "!P( ̐ ` `n( ʐ ` `@ &`!` `* :`  &`&a` 2!`Q( ʐ ` `@&`!` `* :`  &`&a` ?2!`6( ʐ ` ` ( ̐ ` `&&`!` @ * :` ސcX@l&&`&`&aP "!P&`&`&ab 2!b "( ʐ ` `( ʐ ` `@&`!` `* :`  &`&a` 2!`( ʐ ` ` &`&`&aP "!P( ̐ ` ` ( ʐ ` ` &`&`&ab 2!b&&&` 2  㿀7&*`: * *" *L " &`2!d&`& aT*!T&`&a` 2!`&` ![ `* :` &`& a[ *![&  @ *`:& a[*:`#\#`    &  @ *`:& aT*:`#\#`    &  @ *`:( c*`:#\#`    㿀7&*`: * *" *L " &`& a[ *![#H @ (&  @ *`:#\#`     &  @ *`:& a[*:`#\#`     &`&a`2!`㿀( ʐ ` `( `Ɣ *( ǔ *@ ( Ȕ @ " &` !T `* :`   @ "   @ " &`!` @ * :`  ( ɔ ސx`@j&` !T `* :`  :` `/`? ' :` `/` '&`!` @ * :`   ސ@j&`  *@&`  *@&  * ` " &`  *@&`  *@&  * a "!&`&`&aH "!H&` !U*`: : `,&`!` @ * :` ސc@j+&`  *@&`  *@&  * ` " /&`!` ` * :` J&`!` @ * :` ސc@i&  @ *`:& aT*`:#\#`    v&`  *@&`  *@&  * ` " &`&`&af 2!fT&`!` `* :` 8&`!` @ * :` ߐ`@i&`!` `* :`  (  Đ@ (& ` X @ *&`!` `* :`  (  Đ@ (& ` X@ *i( `*"@) " @s`" ( "#  `/ !/&`!` @ * :`  ߐ0@iT&` !Z `* :` `  4v  n&`!` @ * :` ߐ`P@i-( /[&`!` @ * :` ߐ`p@i( ɒ @/F( ɒ @( ` ɒ   /&`!` @ * :` ߐ`p@h( ɒ @/  `   /&`!` @ * :` ߐ`@h( / ` J&`!` @ * :` ߐ`@h&  @ *`:& aT*`:#\#`    :&`  *@&`  *@&  * ` " &`&`&af 2!fi*"@@a `  &`&`&ab 2!bp( ʐ ` `&`&`&a@ "!@&`!` h* :` 1&`!` @ * :` ߐ`@hA&  @ *`:& aT*`:#\#`    &`&`&af 2!f&`!` @ * :` ߐa@h 'c'ܐ /P" ` 2 `2  0`4   '`"   4`0"  '`0" i""4@'耢 c&` !U*`:: `P#Đ  : '!@h$$    `4@ )@" )" ) "@'') @ib@ *`')`@ " `'" @V&`&`&ab 2!bp( ʐ ` `&  @ *`:#\#`     &` a*!V&`!` @ * :` &` !V*`: ߐ(@g4ߐaH@g0&  @ *`:& aT*`:#\#`     'c'ܐ /P" ` 2 `2 " 0@i""4'耢 &` !V*`:: `&` *&` *& +    " &`&`&aL "!L&` !U*`:: `)&`!` @ * :` ߐa@f&` *@&` *@& * `  " &`!` @ * :` ߐa@f&` *@" #Đ  : '!@f$    `4@ )@" )" ) "@'') @ib@ *`')`@ " &  @ *`:#\#`     ( a* (  Đ@  a*( Đ ` ` ( Ő ` `&` *@&` *@& * `@ " @ ( Đ ` `&`!` @ * :` ߐa@e&  @ *`:& aT*`:#\#`    ]@&` *@&` *@& * `` " `&`&`&aD "!D&`!` @ * :` ߐb@e&  @ *`:#\#`     ( a* (  Đ@  a*( Đ ` `( Đ ` ` ( Ő ` `( Đ ` ` ( Ő ` `&` *@&` *@& * `@ " @P&`!` @ * :` ߐb(@e-&  @ *`:& aT*:`#\#`    @&`!` @ * :` ߐbP@e &` *@&` *@& * ` " `'" &  @ *`:& aT*:`#\#`    i@&`&`&ab 2!b㿈/* :& * :+ & + ;` +`ߐbx  @d㿈ߐb'&` !T `* :` ߐb'ߐb@d& ߐa@@d& ߐaH@d& ߐ8aL@d& ߐXaD@dz& ߐxaP@dsߐc@doߐc@dkߐc@dg7* :` &` !U*`:*`:: `ߐc@dMߐc@dG  7`@d=7* :` & * :*@ @d(  7`@d7* :` &`*`: *``@d  7`(@c7* :` &`*`: *`@c  7`8@c7* :` &`*`: *` @c  7`H@c7* :` &`*`: *`@@c  7`X@c7* :` &`*`: *`@c  7`h@c~7* :` &`*`: *`@ch  7`x@c^7* :` &`*`: *`@cH  7`@c>7* :` &`*`: *a@c(  7`@c㿈&  @ *`:( c *`:#\#` $   㿈&  @ *`:( c*`:#\#` $   㿈&`*!U&`"!@&`"!H&`"!L&`"!D&`*!_&`*!Z&`*!W&`*!X&`*!Yi?"" &`"!P&`2!`7* :` X&`*`: *" &`*`: *@" &`*`: *@" @&`*`: *@" `&`*`: *@" &`*`: *@" &`*`: *@" &`*`: *@"!&`*`: *@"!   7&` *!T&` *![&` *!\&`?*!]&`*!^&`2!b&`2!f&`2!d㿈'D'HD  H &" I"@ @ `DH@b-'쀢 4& @*`D" *`$H" &`" *`$D  *`$H" `'㿐@/a/aĮ ??? ??㿐㿠!&!(31addrerr&##(80afn&#$(83aicontrol&#(75aifast&#(64ailoc&:*#*#(1aimode&#(78ainorci&#(65airci&#(66aireset&#(63aiswitch&#(27aitint&#(61aitreset&#(62altf&#$(83altfn&#$(83autorecover&(47autorecovery&(47autoreset&#(73bank&#(71baud&#(2burst&#(74checksum&:***+##(11compare&(3config&$(29cserr&##(81cursor&#(56delay&#(25dev&:*(100dialog&(52display&*(30dump&:@(4edit&:*@(5exit&##(50fast&&(51fastport&$(60ffill&:@(7file&$*:*&(32fill&:@(7find&**#@(10fion&:(98fn&#$(37gasrd&#(68go&(33gxint&#(69help&$(34high&(8holda&#(82hso&***(9image&$*:*&(35intlen&#(67k&:***+##(11light&#(57load&(12log&$#(70man&:*(99map&#(41modein&$(76modeout&$(77move&:***(13noaddrerr&#(26noautorecover&(47noautorecovery&(47noautoreset&#(73nochecksum&#(24nocursor&#(56nomap&#(41notimer&#(58noverify&(22number&#(14ppmode&#(46parallel&$(16ppbus&$(53pponly&$(17output&$(15opt&:**(96reqack&#(82restart&(42reset&#(44resetfp&(72rom&:%(18save&$:@(45search&**$(10serial&:#(21sleep&#(84slow&(54socket&:%(36spd&:*(89status&(59stop&(19test&#(20timer&#(58ulock&(39verify&#(22version&:#(48word&#&(23write&:*(49~$*:*&(32@&$(47A&#(27a&:*#*#(1ai&#(1aic&#(75aif&#(64aim&#(78ainri&#(65airi&#(66aire&#(63aiti&#(61aitr&#(62ar&#(73b&#(2B&#(74ba&#(71C&$(29c&(3cu&#(56d&(52D&*(30dl&#(25e&:*@(5F&(40f&:@(7fa&&(51fi&**#@(10fp&$(60gi&(69gr&(68h&(8ha&#(82H&&(51i&$*:*&(35I&***(9il&#(67j&$*:*&(36l&(12L&(79li&(57M&#(39m&:***(13mi&$(76mo&$(77n&#(14noar&#(73O&#(41P&#(46p&$(16pb&$(53q&$(17o&$(15R&#(44r&:%(18ra&#(82rfp&#(72S&(54s&:%(36sa&$:@(45se&**$(10sn&:#(21st&(59T&(58t&:##(20ts&#(20U&*(47v&(22ver&:#(48w&#&(23W&:*(49x&#(24z&#(26.file&$*:*&(32.h&$*:*&(32.i&$*:*&(35.image&$*:*&(35.j&$*:*&(36?&$(34ai&:*#*#(28ar&*(47auto&*(47bpe&+:*(91bu&#(74cee&+:*(93chip&:(95d&:@(4F&**#@(10flog&:$(97foff&:#(86fon&:#(85fr&:**(88fw&:**(87gasrd&(68gxint&(69h&$*:*&(32l&$*:*&(12li&$*:*&(38limage&$*:*&(38load&$*:*&(12log&#(70quit&##(50r&#(44R&:%(18rp&#(99s&$:@(45S&**$(10sec&:*(94see&+:*(92sl&#(84T&#(58test&:##(20v&:#(48x&##(50X&##(50Must include 'word=' statement BEFORE the 'fill' to workMust have AI Rev3.1 for this to work!No link with units - I am not talking to the TargetNo operation! - you terminated the operationNot emulating! - do a 'go' firstCan't do while Emulating! - must do 'stop' firstKey NOT Assigned - press some other keyData over-run - your host is too busy try 'slow' in ini file if using serial portOperation terminated by user - as you wished!Unit can't detect any RAM, check power level to the Emulator & retryNot enough units to emulate the word-size or configuration check syntax of 'word' commandUnit is LOCKED - sorry!Bad data in hex record corrupted data file or wrong type fileBad argument for driver call - report to GEIFeature not supported on this unit!Bad checksum in record - hex record checksum doesn't computeBad arguments - check command syntax for parametersLoadICE internal error #3 - report to GEIAddress out of range can't load this data in this ROM (configuration)Invalid unit ID - check to see how may units there are?Verify failed - transmission error, check host cablingFEATURE NOT IMPLEMENTED YET! - sorry!Timed out waiting for responseName too long - filename can't be this longCommunication error - cycle power on your units and retryBad parameters to picmd() - report to GEIEnd-o-File - unexpected end of file encounteredBad port name - check serial or parallel port nameDevice I/O errorUnable to skip file data - disk I/O errorOpen failed - check filename, path or spelling of nameInvalid ID list - check syntax, I can't figure out your wordsizeInvalid word-size - must be a multiple of 8, like 8, 16, 24, 32 etc.Invalid ROM size - example: use like: 27c010, 128k or 131072Invalid baud-rate - only 1200,2400,4800,9600,19200 & 57600 allowedFilename error - check path or spellingExpected argument not supplied - check command syntaxToo many arguments supplied - check command syntaxLoadICE parser internal error #2 - report to GEIIllegal command - check your input syntaxLoadICE parser internal error #1 - report to GEICommand failed - Feature not implementedCommand failed - No data available from the targetCommand failed - DataOverflow - lost host dataCommand failed - Timer expired while waitingCommand failed - Interface is BUSYCommand failed - Interface is not available or not activeNo error - you should never see this -L - don't load ROMs before entering dialog mode -l - load ROMs before going into dialog mode -d - go into dialog mode -O [0|1] - turn data range display ON or OFF (default is ON) -F - don't fill ROMs (override -f or fill in ini file) -z [1] - ignore address out of range errors 1/display bad records -x [1] - don't check hex record checksum 1/display bad records -v - don't verify down-loaded data -i filename fileInfo - binary file specs filename fileInfo - hex file specs -w size,byteOrder - emulation word size -f [id:]hex - fill character -r [id:]size - emulation size for ROM(s) -n # - number of PROMICE units connected (UNIX only) (a=2's comp; A=1's comp) store bytes per size [default is one] -k [id:]start end store x|a|A size - compute checksum xor or add method -H - fast host, make pport strobes longer -fp hostname - Ethernet FastPort hostname -q [lpt]n[:address] - parallel port for bidirectional i/o -p [lpt]n[:address] - parallel down-load only port -b rate - baud rate -o name[:address] - serial output device Example '@new.ini -d' will process the new.ini file and go into dialog mode @ - if first char is '@' use the following string as 'ini' file . - if first char is '.' don't look for any ini file ESSENTIAL PARAMETERS ON THE COMMAND LINE:-more (press ENTER or ) this fact can be used to operate the entire interface from a batch file any line in 'ini' file that begins with a '.' will be executed immediately ' store one two or four bytes depending on size, default is one 'checksum [id:]start end store x|a|A size' -checksum ROM after loading 'load' - load files before entering dialog mode 'dialog' - enter dialog mode 'fast' - we have a fast host (486 or 40MHZ 386) use long strobe on pport 'nocursor - disable the spinning cursor, handy on some displays 'noaddrerr [1]' - ignore address out of range error / 1 - show bad records 'noverify' - don't verify downloaded data, use for faster loading 'image=name skip=[id:]address[word,byteOrder]' - binary file ' be down-loaded in parenthesis, i.e. (200,7ff) after the file specs ' you can also specify a partial load by putting the range of data to 'file=name offset=[id:]address[word,byteOrder]' - hex file specs 'word=size[byteOrder]' - specify word size and byte order i.e 'word=16 1 0' 'fill=[id:]hex' - specify ROM fill character - ROMs filled before loading 'map [0|1]' - display range of data being down-loaded, also 'nomap' 'socket=[id:]size' - when socket is wired for a larger ROM than emulating 'rom=[id:]size' - set emulation size, for one or all ROMs 'fastport=hostname' - specify Ethernet FastPort hostname 'ppbus=[lpt]n[:address]' - parallel down-load only bus cable in use 'pponly=[lpt]n[:address]' - bidirectional parallel device name 'parallel=[lpt]n[:address]' - parallel (down-load only) device name 'baud=rate' - 1200,2400,4800,9600,19200,57600 'output=name[:address]' - serial device name (and optional address in DOS) 'fn#=string and afn#=string define the function keys for use in dialog mode PARAMETERS IN THE 'INI' FILE: i.e. 'set LOADICE=loadice2.ini' and in UNIX etc. also 'export LOADICE' ('ini' file may be specified by the environment variable LOADICE) Following may be specified in an initialization file 'loadice.ini' Use any of " ,:=[](){}" these break characters in input Command Line arguments override 'ini' file Items in [..] are optionalEssential LoadICE Initialization File and Command Line parameters: size is specified in the same way as ROM size the interface is running in transparant mode of the AI interface from the host when is plugged into. This allows for proper addressing allows setting of socket size where the unit syntax: socket sizeset the socket size of target system for AI usesocket target is accessing ROM will show if target power is ON and if the if the micro-code supports it then LoadICE report target system status if emulating. syntax: streport target system statusstatus use to terminate operation both command keep looking for more matches use find of F and search of S find finds binary data bytes and search searches strings syntax: find|F start end length data OR search|S start end stringfind data or string in memoryfind - operating system via the 'system()' syscall - then the 'string' is passed to the host - if your system supports this feature syntax: !stringescape a command to the host shellscmd - if # = 1 print records with error - if # = 0 don't print records with errors syntax: z #ignore address-out-of-range errors in user data filesignore - a=store 2's complement A=store 1's complement x=store result - size is the length of result in bytes to store - checksum is stored at the given address - a|A='add all bytes' or x='xor all bytes' method - compute checksum on the ROM given using either syntax: k [id:][start,end,store]/a|A|x sizecompute checksum / or ignore checksum errors in user filechecksum - by specifying the IDs making up the word - change the current word size syntax: w size[byte order]change the ROM configurationword - use the ESC key to toggle this mode - allows editing loading dumping - target is stopped (reset asserted) - put unit(s) in load mode syntax: stopstop emulationstop Example: 'spd 80' will protect sector #7 by default all sectors are unprotected, i.e. spd=00 a bit set implies that sector is protected each bit corresponds with the sector number (or group) set the hex value as sector protection byte syntax: spd #sets sector protection dataspd example: 'seeT' create timeout (ETL) on all SEs Capital letters indicate make error on all SE instructions use see with a=AND, t=Timeout, x=restore syntax: see{a|A|t|T|x|X} #create sector erase error in Flashsee show accumulated statistics on sec# given syntax: sec #show statistics on the sectorsec - 'start' and 'end' allow partial save - else data is saved per config - if ID is given only save that ROM - save data to file 'name'd syntax: s name [id:][start, end]save ROM contents to disk filesave 3 - MOVE data to location 2 - AND data to location, period 1 - ETL if location is not FF 0 - AND data to location and ETL if 0->1 attempted number is 0,1,2,or 3 syntax: opt #set operating options for FlashICEopt use 'dev ##' to set device code by default it is set to 01 - AMD use this command to set 8-bit manufacturer's code syntax: man #set the manufacturer's codeman - use 'li' if binary file in [fileInfo] - same as '.h' followed by 'l' - specified hex file only - if [fileInfo] then load the - load all files specified syntax: l [fileInfo]load file data to the PROMICE chainload - you may use the ESC key for toggling this mode - after editing loading dumping etc. - allows the target to execute (releases reset) - undoes 'stop' - put units into emulation mode syntax: goput units into emulation modego - use 'address' to map file to the right place - - 'skip' is the amount of data to skip from begining of the file syntax: i name [skip=[id:]address word byte order (start end)]specifies a binary file for down loadingimage use 'foff' to stop the monitor you may want to do that if logging stuff to a file use 'fon 0' if you don't want verbose output the host does all the emulation of flash device starts the Flash Monitor on the Host syntax: fon #turn the Flash Monitor onfon log is a binary file use flog utility to view the log filename is flashice.log by default use it to log all the Flash traffic to a file syntax: flog [filename]log all the flash traffic to a fileflog with fioff its just a rom emulator 'fioff' can turn emulation off this keeps things clean while connecting then LoadICE must issue fion for flash emulation turned back on when LoadICE connects with FlashICE, FlashICE turns off emulation syntax: fionturn on the flash emulation in FlashICEfion - specify partial load range in '(' ')' - don't specify ID if word info is given - use 'offset' and 'address' to map file to the right place - use 'i' for binary files and 'j' for formatted binaries - 'h' is for hex files syntax: h name [offset=[id:]address word byte order (start end)]specifies a file for down loadingfile - if 'size'>32 then also give 'data2', if no ID fill current config - they are 'start' address and 'data1', else all three are given - if one arg given then it is 'data1', if two args given then - with their previously specified 'fill-character' - if no arguments are given then all ROMs are filled syntax: f [id:][start] [end] [data1, data2] [size]fill one or more ROM locations with patternfill - type new data, x or . for exit, for next loc, ^ to backup pointer - if no data is given the location is opened and displayed - in multibyte configuration the entire word is changed - the addressed location will be changed to given data - if address and data list is given, edit and done else interactive syntax: e [id:][address] [data, data, ....]edit ROM contents:edit Try different levels and see how much detail can be seen Default levels are very-high and high. - medium-low, low, low-low, very-low - very-high, high, medium-high, medium, - LoadICE application. The eight bits represent eight levels syntax: D ff - the hex value sets the mask for display levels withinchange the output level of LoadICE:display - a will result in repeated dumps at subsequent address ranges - as ASCII characters. - or from the specified ROM, data is displayed in hex as well - dumps either per current config (can be changed with 'word') syntax: d [id:][start, end]dump one or more bytes of ROM space, hex and ASCII data is displayeddump cfg - display current rom configuration file - display information about each file rom - display information about each emulation module link - display only the PROMICE link information all - display all the information syntax: C type - where type can be:display configuration information: various things may be requested:config mismatches are reported then only data in specified range is uploaded and compared if partial down-load was specified with the file(s) instead of down-loading, data is uploaded and compared compares PROMICE contents against file data syntax: ccompares file data with down-loaded datacompare check out the accumulated stats syntax: chipdisplay statistics on the entire Flash Chipchip example: 'ceet' create timeout (ETL) on next CE Capital letters indicate make error on all CE instructions hex data pattern is AND'd or just a timeout occurs use cee with a=AND, t=Timeout, x=restore syntax: cee{a|A|t|T|x|X} #create chip erase error in Flashcee example: 'bpea e7' AND requested program data with 0xE7 else error occurs only on next operation Capital letters indicate make error on all BP instructions hex data pattern is AND'd OR'd or just a timeout occurs use bpe with a=AND, o=OR, t=Timeout, x=restore syntax: bpe{a|A|o|O|t|T|x|X} #create byte program error in Flashbpe - you may use ? with one or more letters to select a topic - fion & fr Flash related commands: fon,spd,man,chip,sec,bpe,see,cee,flog, - (see more commands in the manual) items in '[..]' are optional. save,socket,status,stop,word,checksum,scmd,find compare,config,dump,display,edit,exit,fill,file,go,image,light,loadDialog mode command help: USE '? topic' for more help; some topics are:?Copyright (C) 1990-1997 Grammar Engine, Inc.LoadICE Version 3.9a for SOLARIS w/Serial/Parallel/Ethernet-FastPort %s %s Exiting LoadICE - exit code %d Terminating LoadICE - exit code %d output=/dev/ttybbaud=19200help %sLOADICEloadice.inir.ini Opening command file '%s' File not found '%s' - proceeding Executing command line '%s'l Entering dialog mode Auto-recvery...restart Can't talk to the units - type 'restart' %sFlashICE: LoadICE: LOADice: %03d|%02d:%02d:%02d:%02d:%02d:%02d:%02d:%02d:%02d: ,:=[](){} " parsing `%s`%d ps_str=`%s` ps_emb=%ld ps_id=%d Nums(%d): %ld List(%d/%d): Verified Transferred %ld (0x%lx) data bytes >PiAiloc() >PiBrate() >PiCompare() >PiDump() >PiEdit() >PiFill() >PiHigh() >PiHso() >PiSearch() >PiChksum() >PiLoad() >PiMove() >PiNumber() >PiOuput() >PiStdpp() >PiBidipp() >PiRomsize() >PiStop() Now in Load Mode! Use 'go' later to emulate >PiTest() Test complete Unit %d failed test @loc %lX Unit %d passes test Down loading pattern: Uploading and checking data: Error @ %lX Got-%lX Want-%lX SUM-%lX >PiSerial() serial#=%02X%02X%02X%02X >PiVerify() >PiWord() >PiNoCksm() >PiDelay() >PiNoaddr() >PiAisw() >PiAITTY()%c >PiDisCfg()aUnknown config type - doing all >PiDisply() >PiSystem() >PiFname() >PiGo() Now Emulating!? %s No help available on topic '%s' >PiImage() >PiSocket() >PiFkeys() >PiiLoad() >PiUlock() >PiNofil() >PiMeMap() >PiRecover() >PiReset() >PiSave() >PiPpmode() >PiAutoRecover()PromICE >PiVersion()ROMboyFlashICE %s / %s microCode version %s >PiWrenb() >PiExit() >PiFast() >PiDialog() >PiBus() >PiSlow() >PiCursor() >PiLite() >PiTimer() >PiStatus() STATUS: Target power is ONOFF - Target is NOT accessing ROM STATUS: Unit(s) in LOAD mode >PiNet() >PiTaint() >PiTarst() >PiAirst() >PiAifast() >PiAinorci() >PiAirci() >PiTintl() >PiGasrd() >PiGxint() >PiLog()loadice.logLogfile: Log is ON Log is OFF >PiBank() Banking is OFF Banking is ON with %ld banks >PiNetr() >PiNoar() >PiBurst() >PiAieco() >PiModei() >PiModeo() >PiAiMode() >PiNoLoad() >PiAddrErr() >PiCserr() >PiReqAck() Hold/HoldAck mode ON Hold/HoldAck mode OFF >PiSleep() sleeping %d units >FiOn() >FiOff() >FiWrite() >FiRead() Register -> %02X sed=%02x wrt=%02x%02x%02x/%02x flags[%02x%02x]-AIS-ETL-SUS-SES-CES-BPS-BPN-ICS-SMB-SMA-ERS-ASS-RRS-OVR-HDA-TDA mbi=%02x >FiSspd() spd=%02X >FiMbpe() >FiMsee() >FiMcee() >FiSsec() >FiSchp() >FiSopt() Options = %02X >FiOlog()flashice.logFlashICE Logfile: FlashICE Log is ON FlashICE Log is OFF >FiFiOn() >FiSman() >FiSdev() >RPorts() xaaa00 dd: %02X%02X00 %02X >PiUndef() %lX: %02x %8lX%8lX Dump: word=%d ID %d Bank %ld %08lX: %02X |%s| Connecting.. Please WAIT.. Connection established WARNING! Not enough memory in PromICE to emulate the ROM sizeword=8word=%d Filling config from 0x%lX to 0x%lX fill char = 0x%lX %lX Transferred %ld (0x%lX) fill characters Filling ROM ID = %ld char = 0x%02X Filling ROM ID = %ld data = 0x%lX (via uCode) Saving to file '%s' (data count = %ld) Checksumming Config, Start = 0x%lX End = 0x%lX Storing %ld Bit Checksum @ 0x%lX - LOW Byte First - HIGH Byte First Checksum via addition, storing 1's comp = storing 2's comp = Checksum via exclusive OR, storing 1's comp = 0xas is = 0x%02X Checksuming ROM ID = %d Start = 0x%lX End = 0x%lXstoring 1's comp = 0xstoring 2's comp = 0x %08lX: %08lX: %s This Unit does not support transparant mode AI link PROMICE ID-%d putting AI in transparent mode AILOC = 0x%lX (0x%lX) HostLink - parallel portserial port @ %ld baud BreakCharacter = 0x%02X Binary transparency - no breakCharacter Host interrupts (DTR/INIT toggles) to ignore: ALL%d Opening file `%s` for processing/Done BigBuf-readCount=%ld bufSize=%ld data='%02X%c... CopyIt(ct=%ld)-'%s' HexRec'%s' RecLoc=%06lX ROMLoc=%06lX DataCount=%d Partial-load - skipping above record AddressOutOfRange - '%s' RecLoc=%06lX ROMLoc=%06lX DataCount=%d compare failed - %06lX: f/%02X r/%02X More... HOST TO EMULATOR CONNECTION Network Host: %s Parallel link: Parallel link: %s Standard-mode Fast-mode Turbo-mode Bus-mode Bidirectional Down-load only Strobe-stretch ENABLED, delays are %d,%d,%d Serial link: @%ld baud Serial link: %s @%ld baud (high speed response is on) (slow speed response is on) OPTIONS IN EFFECT: Autorecovery of link on timeout errors ENABLED Req/Ack (Hold/HoldAck) mode is ON Verifying down-loaded data via block-checksum Data verification via block-checksum is OFF Ignoring data that falls outside of ROM address range Not verifying checksum in HEX data files Displaying MAP of data being down-loaded Link: not established AI virtual serial channel to be enabled on exit EMULATION UNITS PRESENT:ROMboy FlashICEPromICE %s ID%d V%4s Memory=%ld Emulating=%ld FillChar=0x%02X Master/Fice/AI-3.1 Slave of %d Banking is ENABLED with %ld banks NO FILES ARE SPECIFIED! Filling of ROM space in effect: Filling ROMs ID = %d Start = 0x%lX End = 0x%lX Size = %lX Bytes Filldata = 0x%lX %lX Filling Config Start = 0x%lX End = 0x%lX Checksum computation in effect: Checksumming ROMs Stored@ = 0x%lX Size = %d Bytes Checksum computed by addition: and stored as 1's complement and stored as 2's complement Checksum computed by exclusive OR Checksumming Config: FILE-%d name = "%s" type = Motorola hexIntel hexTektronics hexHexBinaryUnknown Offset = 0x%lX Skip = 0x%lX Partial Loading of File Data: Start = 0x%lX End = 0x%lX Data Configuration for down-load: Use DEFAULT ROM CONFIGURATION for down-loadNO ROM CONFIGURATION SPECIFIED DEFAULT ROM CONFIGURATION Logging Host/PromICE traffic to file: %s Down-loaded Data Map Data %lx - %lx %s Word Size = %d Current Bank = %ld (0x%lX) Emulation Space: TOTAL Address Range = [0x%lX->0x%lX] IDs = %d Address Range = [0x%lX->0x%lX] -UNKNOWN ERROR CODE > %ld most likely a communication error has occured -ERROR: (%ld) - %s -ERROR-STRING: `%s` -ERROR-LOCATION: `%s` -ERROR-STRING2: `%s` -ERROR-DATA: %lX / %lX -SYSTEM ERROR: CMD: rsp: PI_WRITE:BigBuf/Size=%d (%02X) PI_READ:BigBuf/Size=%d. %02X...MCON 000 000SocketMonitorHOST=%s FastPort hostname Connecting to the FastPort Monitor ConnectMonitorIssuing Reset - 22 seconds wait! Issuing Reset - 11 seconds wait! Connecting to the Serial Port on the FastPort - SocketSerialGot a Socket - ConnectSerial Connected! Connecting to the Parallel Port on the FastPort - SocketParalellConnectParallelConnected! Invalid baud rate %ld changing to 19200 Opening serial device '%s' @BR-%ld Opening parallel device '%s'^ %02x+>*<%02X-%02X.|/-\ PiWrite: loc=%08lX ct=%ld PiRead: loc=%08lX ct=%ld FlashICE Monitor READY %02X%02X %02X%02X%02X %02X Byte Program Seen Byte Program Cycle Illegal Command Seen Erase Seen Suspend Erase Seen Sector Erase Seen Chip Erase Seen Auto Select Entered Read Reset Seen Unlock Sequence Entered Unlock Sequence Complete Illegal Command Sequence byte program: address=%lX data=%X Sector %d Offset %lX Can not program byte - Sector is protected byte program: setting ETL (timeout error) Creating BIT error(s) byte program: data was %02X byte program: data move byte program: data AND byte program: was FF byte program: programming 0->1 setting ETL chip erase: setting ETL (timeout error) chip erase: in progress sector erase: SED=0x%02X sector erase: setting SET (Sector Erase Timer) sector erase: sector %d is protected sector erase: erasing %d - in progress sector erase: suspend erase seen sector erase: operation suspended sector erase: resume erase seen sector erase: operation resumed Sector %d erased %ld times and %ld bytes were programmed in itAM29F010AM29F040 CHIP STATISTICS FOR %s: Chip Erase Count -> %ld Bytes Programmed -> %ld Sector Erase Count -> %ld Erase Suspend Count -> %ld Illegal commands -> %ld Sector number 0 1 2 3 4 5 6 7 - - - - - - - - Protected? YES NO Erase Count %ld Suspend Erase Resume Erase Prot'd Erase Aborted Erase Bytes Pgm'd err-ETL err-Prot'd TotBytesPgm'd END OF CHIP STATISTICS Data %08lX-%08lX`P@0 p`P@0 p`H0xhXH80 xhXH8(pXH8(xh`XPH@0( xph`PH@8( xxph`XPH@80(8(xpX`PH@@0xphXHp8(` 0@ @(xhXH0 p`P@0x hXxHp8hPH@8(xhp``''H' &&&&X& %%%%H% $$$P$####P# """"`"8"!!!P!    @ (Pp@5555h5 444p4 333X3222P211h1000@0//h/ ...x.0---H-(,,,x,(++++h+8+**p*8*))))`)8(((x(8(''Y(XXX`XWWWWxWPW0VVVxVHVVUUUUPUVHTTTTThT`T`T`T`TXT(TSSSpS0SSRRRpR8RQQQQPQ0PPPP@P8P0POOOPO(NNNNNhN MMM`MMLLLhL0KKK`KXK0JJJJHJIIIII`IHHHHHhHHHGGGT`GGGxGPGFFFFFPFEEEJIExEXEHE EDDDpDhD@D(DCCCChC`C@C0BBBT`T`BBxBhBPBAAAAAA`A@A@@P8@@@@XT`T`T`T`@P@(@?UP?VH?`?X?8?(>>>>P> >>======X=P=0=<<===<?:;<=>?@ABCDEFGHIJKLMNOJKLMNOPQRSTUVWXYZ[\]^_Z[\]^_`abcdefghijklmnojklmnopqrstuvwxyz{|}~z{|}~$%&  !"#'()*+,-./0123456789:;<=>?@Aw8Lg  @ H8  L4 00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000000000000~ <values-Xa.cXt ; V=2.0@(#)SunOS 5.5.1 Generic May 1996as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2.1GCC: (GNU) 2.7.2.1GCC: (GNU) 2.7.2.1GCC: (GNU) 2.7.2.1GCC: (GNU) 2.7.2.1GCC: (GNU) 2.7.2.1GCC: (GNU) 2.7.2.1GCC: (GNU) 2.7.2.1GCC: (GNU) 2.7.2.1GCC: (GNU) 2.7.2.1GCC: (GNU) 2.7.2.1GCC: (GNU) 2.7.2.1GCC: (GNU) 2.7.2.1GCC: (GNU) 2.7.2.1GCC: (GNU) 2.7.2.1GCC: (GNU) 2.7.2.1as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2.1.symtab.strtab.shstrtab.interp.hash.dynsym.dynstr.rela.bss.rela.plt.init.text.fini.rodata.data.ctors.dtors.got.dynamic.plt.bss.stab.index.stab.indexstr.comment#P) 881 H H9$ C44 MS((Y@@_XXnrgmt{LL ``nD` x<"  D        (>M [fms>M 4  Lm>>m>t 4P m>"  #*,01.88/>0x\E1L3Q/X8x`j4,mp>:,yoxGq(PqWw`xhy@qyx{x}Xx~Xt0ht  ,XtH4P@P8pT4 T0|$+<(2dP;4CKS[bjsy`HHH8HHLl(<|HP@P '<08=żXCpKDŽRLtY `gPnuX|L T\\ $<m>(m>m>I` d f p0op@ P W"Y+[4]08=`hF`OaXhP(acjgPtix4}c@e\fHd`m>r4m>tm>\m>p x |  l$ m>ǐm>޼'  *,047:A pH 8O \U ,\m[>xmckTrXz\^|h" `d"9<dhxjlpx"xt0x 5 x %,0+3x$;|BlIRQ4ZaƔ kAHTryt$`@:,D)p ,\ ((Ơ  "  ' 0 5<$C$"IR(`Yh btDk t{` 4,"LAx0HV$8";  L $ *ݘ 2¨ 9 ?  E0$" Kd R Z b i r z\     `  x`  <p h    H$      T@ t $ H|  > LD && - 6( <x  B  J< T* ]r e, k0 r8 x4 ~8 < x @ (t @ D H H `D" l$ L- ( T\ L M  p t x | ~ xT   %Ӏ -Ӂ 3Ԇ 9Ԉ BԌ IԐ P X4 ^` j q vI } T 8 Ԕ     "  Ԙ Ԝ 0l ޼    " Ԡ \ Ԥ |t Ԩ Ԫ  ֬ #x 1@  7  =r4 FT N Uְ [< ch j8 o< vִ ~ָ 8h < 'l ּ Z '| Ü, <   @  X t  @  Ӡ@ D H ` ( L  0  5P` > F $ K Q Z e  k\ t y l    P  t         ǐ 8   ,$xh #` (/85h@; AHTTQX_hpwD"}P$04'hcrtstuff.c__CTOR_LIST____DTOR_LIST____do_global_dtors_auxgcc2_compiled.force_to_datafini_dummycrti.s*ABS*__do_global_ctors_auxinit_dummy__DTOR_END____CTOR_END__crtn.s.nopevalues-Xa.cpiglob.cloadice.cpishell.cutimepikeyst.6pisyn.cps_brkps_swps_endps_nunpsips_radps_synpsgetspscharpsnumpsnumlpsnumspsidpslinepsbreakps_stringpsrdxpisynf.cpiailocpibratepicomparepiloadpidumppigetcfgpftcfgpieditpifillpihighpihsopisearchpichksumpifnamepimovepinumberpiouputpistdpppibidipppiromsizeonce.38pistoppitestgeitestfillerpiserialpiverifypiwordpinocksmpidelaypinoaddrpiaiswpiaittypidiscfgpidisplypisystempifmorepigopihelppiimagepisocketpifkeyspiiloadpiulockpinofilpimemappirecoverpiresetpisavepippmodepiautorpiversionpiwrenbpiexitpifastpidialogpippbuspislowspirlinkpicursepilitepitimerpistatuspinetpitintpitrstpiairstpiaifstpinorcipiaircipitintlpigasrdpigxintpilogpibankpinetrpinoarpiburstpiaiecopimodeipimodeopiaimodepinoloadpiaddrerrpicserrpireqackpiafkeyspisleepfionfiofffiwritefireedfisspdfissedfimbpefimseefimceefissecfischpfisoptfiologfifionfismanfisdevrportspiundefpiedit.cpicore.cpifile.cpiestrspieoffirsttfprqctheretherepi_pixfrgetptrrcahxbasetmptrpi_hxintpi_hxmotpi_hxtekpi_hxetkpi_hxdsppi_hxmospi_hxrcapi_hxgetpi_csintpi_hxpgetpi_hxputpi_csmotpi_cstekpi_csetkpi_csmosputptrromlocpiconfig.cpidcfgpierror.cpidriver.cpi_dbufpiunix.cpponppoffidonpl_oncehtonspithenttimetopiutil.cfiutil.cidrstastbr0r1fidocefidosefidobpfilodfiemupimap.cps_numlpxbankpxksizepxwritepxcfilestrcpypisynpxmodeopxtcpupi_openioctlpcmovepireadpxackpi_beeppibusypxburstprintfpxfcfgconnectlicatchpxexitvpi_getputimespi_estr1__ctypepirspfirexitdo_outppxkendpi_rsp_DYNAMICpixlateppxdl0pi_switchpcrsttgetenvpiiniterrno_etextpcloadpi_enum2getspcksumps_numpcxinitpipinspxhelpfgetspidoeditpi_putspxhostPIXT2pxmaxpxybcpclogmemcpypxmode1pxtoutperrorpxlstrpxaibrpxmstartmapisystempxnpiusleep__filbufpxkeyspxaicstrpi_closepi_sleeppxrsplpicuct.divpxmode2pxcmodesocketps_bankpicmdpcexitpxaiwspi_cccw_environpxbbcpi_clearxbufpxlogpxrtimelseekpcfindpi_putppxaibrc_PROCEDURE_LINKAGE_TABLE_pxxbcpiinitrpi_getpxbbf_initalarmpibppepi_cookpxnototpxmendpidodumppi_elocpxlinkfxlogpxfirstpilopps_bchrcpimappxdispcallocserverpidefs2pcmfsynpxcodewritepi_putpi_estr2pxpcfgfclogstrcatpierrorpxaiidpcfillpsynfpcstringpxromspxcrompxerrmsgpxhsopibpppcxfillpi_setimepxaibchrpixbfmtps_lipxcmdlfienbpxdlcps_ipxclocpcinitpxxbf_startpxhintspxfstartpxprompi_ccwsignalreadpxflashpi_writepcmlsynps_charpxldatapi_enum1pxfendpxsendpxnromppxdl2sscanfpi_rawpxmodeipxcmdpxreqpxkstartpxdendps_embpidefs1fopen__bss_startpftypemainpifileliclickpxbaudspxkstorefclosepi_xmtpi_haxmttimepiclhlppxlsizepxtintlpcxksumfiremonstrcmpshutdownpxcfgpi_cmdps_strfishowspxsrompxulinemapspxestartgethostbyname_finifgetcpiconfigsprintfcrightps_idpi_readatexit.rempxromxpxflagspxdbfpiemufishowcpcsavepxelistpptwopcdumpdo_inppi_eflagspi_kbdpxconfig_lib_versionpishellpxelcnthppikickpxctrypiflags_edatapusrsynpxdat_GLOBAL_OFFSET_TABLE__endpxaltcfgpxailocmapepxdbcpxdstartpi_chktimepxrompifixcfgexitpxmdestsetbufpxdelaypxfsizepxsstartpilodpxlstartpi_togglepxybfpxbankspxrsppxlendpxcline_exitpxaiecofpsockpiwritepxfdatapiinitfstrlenfiinitopenPIXT1PIETpxxloc.umul__iobliverpi_rcvpi_delaypxacfgumodempxfdata2pxerrorppxdl1fcntlpxylocpi_putp2pxnfileps_sliclosepi_endxpxfileps_bchrpcedit